2. Neurological Disease

Neurological Disease

Neurological Disease

Related Products

PDF 88.0 MB

A range of neurological disorders, including epilepsy and dystonia, may involve dysfunctional intracortical inhibition, and may respond to treatments that modify it. Parkinson’s is a neurodegenerative disease characterized by increased activity of GABA in basal ganglia and the loss of dopamine in nigrostriatum, associated with rigidity, resting tremor, gait with accelerating steps, and fixed inexpressive face. Neurological deficits, along with neuromuscular involvement, are characteristic of mitochondrial disease, and these symptoms can have a dramatic impact on patient quality of life. Neurological features may be manifold, ranging from neural deafness, ataxia, peripheral neuropathy, migraine, seizures, stroke‐like episodes and dementia and depend on the part of the nervous system affected.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-W151617A
    Desethoxy Quetiapine dihydrochloride 329218-14-6
    Desethoxy Quetiapine dihydrochloride (Compound 28) is an antagonist for dopamine D2 receptor with an IC50 of 1330 nM. Desethoxy Quetiapine dihydrochloride antagonises Apomorphine (HY-12723)-induced climbing and swimming disruption in mouse models.
    Desethoxy Quetiapine dihydrochloride
  • HY-W201842A
    Octamylamine sulfamate 96296-56-9
    Octamylamine sulfamate is an anticholinergic and antispasmodic agent.
    Octamylamine sulfamate
  • HY-W240028A
    N-Methylmescaline hydrochloride 6308-81-2
    N-Methylmescaline hydrochloride is a phenethylamine.
    N-Methylmescaline hydrochloride
  • HY-W251284A
    3-Anilinopiperidine dihydrochloride 2751621-53-9
    3-Anilinopiperidine dihydrochloride is a piperidine.
    3-Anilinopiperidine dihydrochloride
  • HY-W424017A
    Lophophine hydrochloride 77158-52-2
    Lophophine hydrochloride is the drug intermediate of anhalonine and Lophophorine (HY-119478), and can be found in Lophophora diffusa. Anhalonine causes slight sleepiness in frog. Lophophorine causes long-lasting convulsions, reflex excitability, muscle stiffness, and paralysis in rabbit and frog model.
    Lophophine hydrochloride
  • HY-W710914A
    rel-HDMP 28 hydrochloride 219915-69-2
    rel-HDMP 28 hydrochloride (Compound 2g) is a methylphenidate analogue that binds selectively to SERT (Ki = 105 nM)[1].
    rel-HDMP 28 hydrochloride
  • HY-W746075A
    (±)-Darifenacin N-Oxide 2416229-88-2
    (±)-Darifenacin N-Oxide is the impurity of Darifenacin (HY-A0033). Darifenacin (UK-88525) is a selective and orally active M3 muscarinic receptor (M3R) antagonist with a pKi of 8.9.
    (±)-Darifenacin N-Oxide
  • HY-W783639S
    Bzo-poxizid-d9
    Bzo-poxizid-d9 (5C-MDA-19-d9, Petyl MDA-19-d9) is deuterium labeled Bzo-poxizid. Bzo-poxizid is a synthetic cannabinoid that is a psychoactive substance.
    Bzo-poxizid-d9
  • HY-W012531S2
    2-Hydroxycinnamic acid-d4
    2-Hydroxycinnamic acid-d4 is deuterium labeled 2-Hydroxycinnamic acid. 2-Hydroxycinnamic acid is a phenolic acid with antimicrobial and antioxidant properties. 2-Hydroxycinnamic acid has antimicrobial activity against Staphylococcus aureus and is not susceptible to drug resistance. 2-Hydroxycinnamic acid shows inhibitory effects on infection of HIV/SARS-CoV S pseudovirus with an IC50 of 0.3 mM. In addition, 2-Hydroxycinnamic acid has neuroprotective and antitumor activity.
    2-Hydroxycinnamic acid-d4
  • HY-W012889S3
    DL-Valine-d1-1 79168-24-4
    DL-Valine-d-1 is the deuterium labeled DL-Valine[1].
    DL-Valine-d1-1
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW 2279952-25-7
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-103344
    ZJ43 723331-20-2
    ZJ43 is a potent NAAG peptidase inhibitor, with an IC50 of 2.4 nM and a Ki of 0.8 nM. ZJ43 sufficiently activates group II mGluR and reduces some of the behavioral effects of PCP. ZJ43 shows an analgesic effect in neuropathic and inflammatory and pain models.
    ZJ43
  • HY-107605
    UBP296 745055-86-1
    UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.
    UBP296
  • HY-115650
    TAE-1 1414469-59-2
    TAE-1 is a potent inhibitor of AChE and BuChE. TAE-1 also inhibits Aβ fibril formation and aggregation. TAE-1 can be used for the researches of Alzheimer's disease.
    TAE-1
  • HY-118301
    ADX71441 1207440-88-7
    ADX71441 is a potent and selective positive allosteric modulator of the GABAB receptor. ADX71441 is bioavailable after oral administration and is brain penetrant. ADX71441 has the potential for research of anxiety, pain and spasticity.
    ADX71441
  • HY-120024
    BMS-986188 1776115-10-6 99.06%
    BMS-986188 is a selective positive allosteric modulator of δ-opioid receptor with an EC50 of 0.05 μM.
    BMS-986188
  • HY-121736
    AGI-12026 1446501-77-4
    AGI-12026 is brain-penetrant dual inhibitor of mutant IDH1 and 2. AGI-12026 shows partial inhibition of the IDH1-R132H homodimer as allosteric modulators. AGI-12026 has the potential for research of glioma.
    AGI-12026
  • HY-135154
    epi-Aszonalenin A 908853-14-5
    epi-Aszonalenin A is a benzodiazepine fungal metabolite originally isolated from Aspergillus novofumigatus. epi-Aszonalenin A can be used as a psychoactive agent.
    epi-Aszonalenin A
  • HY-B0114S
    Oxcarbazepine-D4 1020719-71-4
    Oxcarbazepine-d4 (GP 47680-D4) is the deuterium labeled Oxcarbazepine. Oxcarbazepine is a sodium channel blocker[1]. Oxcarbazepine significantly inhibits glioblastoma cell growth and induces apoptosis or G2/M arrest in glioblastoma cell lines[2]. Anti-cancer and anticonvulsant effects[2][3].
    Oxcarbazepine-D4
  • HY-B0233S
    Isradipine-d3 1189959-59-8
    Isradipine-d3 (PN 200-110-d3) is the deuterium labeled Isradipine. Isradipine (PN 200-110) is an orally active L-type calcium channel blocker. Isradipine, as a powerful peripheral vasodilator, is a dihydropyridine calcium antagonist with selective actions on the heart as well as the peripheral circulation. Isradipine is a potentially viable neuroprotective agent for Parkinson's disease[1][2][3].
    Isradipine-d3
Cat. No. Product Name / Synonyms Application Reactivity